DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Kif11

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_034745.1 Gene:Kif11 / 16551 MGIID:1098231 Length:1052 Species:Mus musculus


Alignment Length:119 Identity:51/119 - (42%)
Similarity:70/119 - (58%) Gaps:10/119 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHT--LDSKLTKK-FTFDRS 69
            :|.:.:::..:||||.||.||.|..||...:..||:....|:.|:..|  |..|.:|| :|||..
Mouse     6 SSLKKKEEKGRNIQVVVRCRPFNLAERKANAHSVVECDHARKEVSVRTAGLTDKTSKKTYTFDMV 70

  Fly    70 FGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGNNL-------RPPKSLY 116
            ||..:||.|||..||.|:::||:.|||||:|||||||...       |.|..:|
Mouse    71 FGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEVY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 45/91 (49%)
Kif11NP_034745.1 KISc_BimC_Eg5 15..367 CDD:276815 50/110 (45%)
KISc 17..365 CDD:214526 50/108 (46%)
Microtub_bind 915..1047 CDD:290642
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 950..1026
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1033..1052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848785
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.