DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and KIF20A

DIOPT Version :9

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_005724.1 Gene:KIF20A / 10112 HGNCID:9787 Length:890 Species:Homo sapiens


Alignment Length:123 Identity:36/123 - (29%)
Similarity:65/123 - (52%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DISGGNTSRQ-----PQKKSNQNIQVYVRVRPL--NSRER-----CIR--SAEVVDVVGPREVVT 52
            |.|..:||.:     |.:.|.:.::||:|||||  :..||     |:|  :.|.:.:..|::...
Human    42 DCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFA 106

  Fly    53 RHTLD---SKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN 107
            ..:.:   .:.|.:|||.:.||||..|...:::.|..::::||.|.|..::.||.|.:
Human   107 LKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 29/100 (29%)
KIF20ANP_005724.1 KISc_KIF23_like 63..505 CDD:276819 30/102 (29%)
SMC_N <547..>795 CDD:330553
Globular. /evidence=ECO:0000255 763..890
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 832..865
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4904
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.