DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33262 and CG34428

DIOPT Version :9

Sequence 1:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:225 Identity:76/225 - (33%)
Similarity:109/225 - (48%) Gaps:37/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CLIF--LQEVASQDVHSRSKR----FLIFPRQAPTRHQFIAGIGIP-ADLEYESLTVGYVLKAEY 71
            ||::  :..:.|...|.||||    :||:|..:|||..||.||||| .||.||::|.|||||.||
  Fly    12 CLLYQVMASLGSLFKHQRSKRAPIPWLIYPTTSPTRVMFIGGIGIPLEDLNYEAVTTGYVLKVEY 76

  Fly    72 YLPYNATVYRQN---PLFPEYKPNTIDAQDQRK----LFMKPTD-------------------LR 110
            :||......|..   ||.....|....|:.|||    .|:...|                   .|
  Fly    77 WLPTTPDDLRTPTALPLTQVATPGVTGARKQRKPMFENFLVGVDELGKNTRKLLTRTNKVLSSYR 141

  Fly   111 WQLYQFIEHMLNGYGLNGHACLLEAICEANNIKFAKDFSTAGEMLHLLLSPSSTLNSESNRA-LD 174
            |.:|:.:|.:.:..|..|..|:|::||||....|........::||:||:|||:::..|..| .:
  Fly   142 WTVYKGLEGLADRLGYQGRICVLKSICEAAEEPFHYTNGLFADLLHILLTPSSSVDKLSEHADNE 206

  Fly   175 FILAEKDG-SRRDCSKY--DCNTKIINWFS 201
            :..|||.| |...|.:.  :|...::..||
  Fly   207 YYYAEKMGQSGAGCDRVFKECRRSLLQHFS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 28/85 (33%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19081
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D151298at50557
OrthoFinder 1 1.000 - - FOG0009993
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.