DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33262 and CG34442

DIOPT Version :9

Sequence 1:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:219 Identity:44/219 - (20%)
Similarity:80/219 - (36%) Gaps:62/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KRFLIFPRQAPTRHQFIAGIGIPADLEYESLTVGYVLKAEYYLPYNATVYRQNPLFPEYKPNTID 95
            |..|:|...  :.:.....|.:|..|.:.::.:.|..:..||.|.:  ||:..|:        :.
  Fly    24 KSALLFTTN--SEYGIFMAISVPIGLPHRNVFLSYNYEFNYYQPEH--VYKYPPI--------LM 76

  Fly    96 AQDQRKLFMK-PTDLR------------WQL--------------------------------YQ 115
            .||....::. ||..|            |::                                |.
  Fly    77 GQDFEDSYLTYPTTGREAEGRHCQNCTDWKIEGNINSTSSNNNSTKAASREKRGLTLMSRSVFYA 141

  Fly   116 FIEHMLNGYGLNGHACLLEAICEANNIKFAKDFSTAGEMLHLLLSPSSTLNSESNRALDFILAEK 180
            .:...|...|.....|||..||:.|..:..:.....|.::|::.||||  :.:.:...::..||.
  Fly   142 MLRDKLRRSGFPAEPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPSS--SKDEHLPNEYYQAEW 204

  Fly   181 DG-SRRDCSKY--DCNTKIINWFS 201
            || .:::||.|  .|:..|::..|
  Fly   205 DGREQQECSTYTKSCDHNILDLVS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 24/128 (19%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D2P6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.