DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33262 and CG34184

DIOPT Version :9

Sequence 1:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001097310.1 Gene:CG34184 / 5740423 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster


Alignment Length:225 Identity:58/225 - (25%)
Similarity:89/225 - (39%) Gaps:43/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRSMWLSVCATLCLIFLQEVASQDVHSRSKRFLIFPRQAPTRHQFIAGIGIPADLEYESLTVGY 65
            || |:.||....|.|||   |.|..::..:..|.||           ..|.:|..|:..::.:.|
  Fly     1 MN-SLALSCFVFLKLIF---VESTLLYQTNSEFGIF-----------MAISVPLTLKNRNVFLSY 50

  Fly    66 VLKAEYYLPYNATVYRQNPL---------FPEYKPNTIDAQDQRKLFMK------------PTDL 109
            ..:..||.|.:  ||:..|:         :..|.....|.....:.|..            |...
  Fly    51 NYEFNYYQPEH--VYKYPPILMGDNWEDSYLTYNTTGGDDSSSSRSFRSVDDNSSTQKRTLPIMS 113

  Fly   110 RWQLYQFIEHMLNGYGLNGHACLLEAICEANNIKFAKDFSTAGEMLHLLLSPSSTLNSESNRALD 174
            |...|..::..|...|....:|||..|||.|:....:.....|.::|:|.:|||  :::.|...|
  Fly   114 RTNFYIMLKDKLERSGYPAESCLLRLICETNSSTLGEVNGLLGSIVHILFTPSS--SNDENLDKD 176

  Fly   175 FILAEKDGSRR-DCSKY--DCNTKIINWFS 201
            :..||.||.|. |||.|  .|...:::..|
  Fly   177 YYQAEWDGLRHGDCSFYASQCEENVLDLIS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 28/84 (33%)
CG34184NP_001097310.1 DM4_12 114..197 CDD:285126 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D2P6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.