DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33262 and CG13613

DIOPT Version :9

Sequence 1:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster


Alignment Length:192 Identity:57/192 - (29%)
Similarity:88/192 - (45%) Gaps:36/192 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LIFPRQAPTRHQFIAGIGIPADLEYES---LTVGYVLKAEYYLP------YNATVY------RQN 83
            |:||  ..|..|..:.|.|||||...:   :.:|:  :..|.||      ||||::      ||.
  Fly    30 LLFP--TSTVLQLTSSISIPADLNTRTKVFMDMGF--QMNYNLPPTVSAFYNATIWADELSRRQK 90

  Fly    84 PLFPEYKPNTIDAQDQR---KLFMKPTDL-RWQLYQFIEHMLNGYGLNGHACLLEAICEANNIKF 144
                ....:::||..|:   :..|.|.|. ..|||:.||:||..||.: .:|||.::||.....|
  Fly    91 ----RQLDHSLDANLQQYDLEGGMHPADFTAGQLYKGIENMLETYGFH-RSCLLRSVCELALHPF 150

  Fly   145 AKD--FSTAGEMLHLLLSPS---STLNSESNRALDFILAEKD---GSRRDCSKYDCNTKIIN 198
            |:|  :....:::..||:||   ...:.|.:....:..||:.   |.:...|...|...|||
  Fly   151 AEDHFYGMVTQVITFLLTPSQHEGFADDEQHYRDKYEKAEQIGFLGGQCHLSYPSCQADIIN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 26/89 (29%)
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.