DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33262 and CG13869

DIOPT Version :9

Sequence 1:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster


Alignment Length:197 Identity:52/197 - (26%)
Similarity:79/197 - (40%) Gaps:40/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCLIFLQEVASQDV-------HSRSKRFLIFPRQAPTRHQFIAGIGIPADLEYESLTVGYVLKAE 70
            |.|..|:.|::.:.       |.|.|||||:......:  |::|...||....:......|....
  Fly     9 LFLFTLEAVSALEANLTSWRHHRRQKRFLIYQNGGVIK--FVSGCAFPAPFMEKKAWRQLVWLMN 71

  Fly    71 YYLPYNATVYRQNPLF---------------PEYKPNTIDAQDQRKLFMKPTDLRWQLYQFIEHM 120
            ::..:|..   |.|::               .:..|.::.|   |.|..:|..|   |::|.|..
  Fly    72 FHYQFNEP---QTPIYWWKLWDGSRNLKGPLTQPAPPSVPA---RLLVDEPQLL---LFKFAEAY 127

  Fly   121 LNGYGLNGHACLLEAICEANNIKFAKDFSTAGEMLHLLLSPSSTLNSESNRALDFILAEKDGSRR 185
            :|..|.||.|||...|||  |.:..:......::||.||.|..||:.   |.||.....:.|.  
  Fly   128 MNQLGQNGSACLDRLICE--NGQVDEHSGLYAQLLHRLLRPHQTLDV---RYLDAYRMGRHGV-- 185

  Fly   186 DC 187
            ||
  Fly   186 DC 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 27/78 (35%)
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 29/84 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.