DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33262 and LOC3290789

DIOPT Version :10

Sequence 1:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_560488.3 Gene:LOC3290789 / 3290789 VectorBaseID:AGAMI1_004907 Length:227 Species:Anopheles gambiae


Alignment Length:153 Identity:41/153 - (26%)
Similarity:66/153 - (43%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PADLEYESLTVGYVL--KAEYYLPYNATVYRQNPLF----------PEYKPNT-IDAQDQRKLFM 104
            |...||....:|..|  :..|.||:....: ..|.:          ..:||.| :.|:|.::...
Mosquito    53 PPKQEYAVRRLGINLGFQVNYNLPFRLLDF-YKPAYWARALIGVVQGRFKPTTVVSARDYKRSVT 116

  Fly   105 KP-TDL-RWQLYQFIEHMLNGYGLNGHACLLEAICEANNIKFAKDFSTAGEML----HLLLSPS- 162
            .| :|| ..|||...|.:|..... |..||.::|||..:..|.::.:...::|    |.||:|| 
Mosquito   117 HPSSDLTAGQLYHAAEELLQAMEF-GADCLAKSICELAHSPFHREPNGREDVLMEVAHFLLTPSF 180

  Fly   163 --STLNSESNRALDFILAEKDGS 183
              |...||....:.:.:||..|:
Mosquito   181 HRSFGESEYRDRVKYEMAENLGA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33262NP_996071.2 DM4_12 110..192 CDD:462285 24/81 (30%)
LOC3290789XP_560488.3 None

Return to query results.
Submit another query.