DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HB52

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_200209.1 Gene:HB52 / 835481 AraportID:AT5G53980 Length:156 Species:Arabidopsis thaliana


Alignment Length:56 Identity:19/56 - (33%)
Similarity:35/56 - (62%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 KRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK 283
            |..:...|..|:.:||:.|:.|..|....:::::|:|.|.::||.:||||:|.:.|
plant     9 KNKKKRLTQDQVRQLEKCFTMNKKLEPDLKLQLSNQLGLPQRQVAVWFQNKRARFK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 19/56 (34%)
HB52NP_200209.1 Homeodomain 11..64 CDD:459649 17/52 (33%)

Return to query results.
Submit another query.