DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HB-3

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:158 Identity:41/158 - (25%)
Similarity:63/158 - (39%) Gaps:44/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PNSQQLP--PIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDY----------TNNFDEPQGK 190
            |:...||  |.|..||    ||      |::..:.|.|.:...|:          |||.::..  
plant    43 PSPTSLPSCPPHLFYG----GG------GNYMMNRSMSFTGVSDHHHLTQKSPTTTNNMNDQD-- 95

  Fly   191 RFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRL 255
            :...|.:.|.:.|    |...|            :..||:..    .|:..||:.|.....|...
plant    96 QVGEEDNLSDDGS----HMMLG------------EKKKRLNL----EQVRALEKSFELGNKLEPE 140

  Fly   256 RRIEIANRLRLSEKQVKIWFQNRRVKQK 283
            |::::|..|.|..:|:.|||||||.:.|
plant   141 RKMQLAKALGLQPRQIAIWFQNRRARWK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 20/56 (36%)
HB-3NP_568309.2 Homeodomain 115..168 CDD:459649 19/56 (34%)
HALZ 170..208 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.