DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HB20

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:149 Identity:38/149 - (25%)
Similarity:57/149 - (38%) Gaps:44/149 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 NSQ-QLP--PIHNLYGSPVVGGLPLPEPGSFCTSPSAS-SSASLDYTNNFDEPQGKRFKHESSCS 199
            ||| |||  |.|...|.           |::..:.|.| .:...|:....||             
plant    32 NSQDQLPSCPPHLFNGG-----------GNYMMNRSMSLMNVQEDHNQTLDE------------- 72

  Fly   200 PNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRL 264
                  :|.|..|...:      ..:..||::.    .|:..||:.|.....|...|:|::|..|
plant    73 ------ENLSDDGAHTM------LGEKKKRLQL----EQVKALEKSFELGNKLEPERKIQLAKAL 121

  Fly   265 RLSEKQVKIWFQNRRVKQK 283
            .:..:|:.|||||||.:.|
plant   122 GMQPRQIAIWFQNRRARWK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 20/56 (36%)
HB20NP_186771.1 Homeodomain 87..140 CDD:459649 19/56 (34%)
HALZ 142..183 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.