DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HB-1

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_186796.1 Gene:HB-1 / 821138 AraportID:AT3G01470 Length:272 Species:Arabidopsis thaliana


Alignment Length:129 Identity:37/129 - (28%)
Similarity:57/129 - (44%) Gaps:16/129 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 EPGSFCTSPSASSSASLDYTNNFD---EPQGKRFKHESSCSPNSSPLKNHSSGGPVEITP--LIN 221
            |..||...||||...|:.:..|.:   :..|.|         :...::..|...|...:|  |.:
plant     2 ESNSFFFDPSASHGNSMFFLGNLNPVVQGGGAR---------SMMNMEETSKRRPFFSSPEDLYD 57

  Fly   222 D--YADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK 283
            |  |.|.....:...|:.|:..||:.|.....|...|:.::|.:|.|..:||.:||||||.:.|
plant    58 DDFYDDQLPEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 19/56 (34%)
HB-1NP_186796.1 Homeodomain 68..121 CDD:459649 18/52 (35%)
HALZ 123..164 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.