DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HB22

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:136 Identity:39/136 - (28%)
Similarity:58/136 - (42%) Gaps:27/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 SFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSS---------PLKNHSSGGPVEITPLI 220
            ||....|:||..|..|  |||...|.:   ::.|.....         ||....||...|    .
plant     7 SFIDGASSSSFISPFY--NFDHFSGNQ---DNRCLGTMMGAQQDILHVPLAMVESGYGEE----S 62

  Fly   221 NDYADSSKRIRTAFTSTQLLELEREFSHNAYLS-----RL---RRIEIANRLRLSEKQVKIWFQN 277
            |.:....|: :...||.||..|||.|.....|:     :|   |:::::..|.|..:|:.:||||
plant    63 NSFNGQEKK-KKKMTSEQLKFLERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQIAVWFQN 126

  Fly   278 RRVKQK 283
            |:.:.|
plant   127 RKARWK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 21/64 (33%)
HB22NP_850266.1 Homeodomain 70..133 CDD:459649 21/64 (33%)
HALZ 134..167 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.