DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HB6

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:128 Identity:30/128 - (23%)
Similarity:49/128 - (38%) Gaps:31/128 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 TSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRI-- 230
            :|.|.....||..|.:.||...:|:                   |..|...::..|.:..:.|  
plant     7 SSDSVGGLISLCPTTSTDEQSPRRY-------------------GGREFQSMLEGYEEEEEAIVE 52

  Fly   231 ----------RTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK 283
                      :...:..|:..||:.|.....|...|::::|..|.|..:||.:||||||.:.|
plant    53 ERGHVGLSEKKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 19/68 (28%)
HB6NP_565536.1 Homeodomain 62..115 CDD:459649 17/52 (33%)
HALZ 117..158 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.