DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HB17

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:101 Identity:30/101 - (29%)
Similarity:44/101 - (43%) Gaps:20/101 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 NSSPLKNHSSGG-------PVEITPLINDYADSS-----------KRIRTAFTSTQLLELEREFS 247
            :||||.:..|||       .:...|...|..|..           |::|  .|..|...||..|.
plant    94 SSSPLSDEGSGGGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLR--LTREQSRLLEDSFR 156

  Fly   248 HNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK 283
            .|..|:..::..:|..|.|..:|:::||||||.:.|
plant   157 QNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 20/56 (36%)
HB17NP_178252.2 HOX 136..192 CDD:197696 19/57 (33%)
HALZ 194..237 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.