DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and NANOG

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_079141.2 Gene:NANOG / 79923 HGNCID:20857 Length:305 Species:Homo sapiens


Alignment Length:185 Identity:57/185 - (30%)
Similarity:76/185 - (41%) Gaps:44/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 YPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFK 193
            |||..:|    |.::|....:        .|||.........|..||.|         |:||:  
Human    35 YPSLQMS----SAEMPHTETV--------SPLPSSMDLLIQDSPDSSTS---------PKGKQ-- 76

  Fly   194 HESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRI 258
               ..|...|..|.... .||:           .::.||.|:||||..|...|....|||..:..
Human    77 ---PTSAEKSVAKKEDK-VPVK-----------KQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQ 126

  Fly   259 EIANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNGSPQ--ASPVSPQV 311
            |::|.|.||.||||.||||:|:|.|:....    |...||||..|  ::|..|.:
Human   127 ELSNILNLSYKQVKTWFQNQRMKSKRWQKN----NWPKNSNGVTQKASAPTYPSL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 27/55 (49%)
NANOGNP_079141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 21/98 (21%)
COG5576 74..191 CDD:227863 43/125 (34%)
Homeodomain 97..152 CDD:459649 27/54 (50%)
Required for DNA-binding. /evidence=ECO:0000269|PubMed:25825768 122..151 15/28 (54%)
8 X repeats starting with a Trp in each unit 196..240
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.