DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and lbx1b

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001156784.1 Gene:lbx1b / 793810 ZFINID:ZDB-GENE-050309-27 Length:265 Species:Danio rerio


Alignment Length:122 Identity:43/122 - (35%)
Similarity:55/122 - (45%) Gaps:27/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 DYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGG 286
            |.....::.|||||:.||.|||:.|.|..|||...|.:||::|.|:..||..||||||.|.|:..
Zfish   116 DSPKKRRKSRTAFTNHQLYELEKRFLHQKYLSPADRDQIAHQLGLTNAQVITWFQNRRAKLKRDL 180

  Fly   287 SESPTFNLSTNSNG-------------------------SPQASP-VSPQVK-VHEL 316
            .|......|..|.|                         .||.|| :..:.| ||:|
Zfish   181 EEMKADVESVRSTGLVPLDKLAKLADLERCAAAGATGNPGPQCSPRLGHEYKTVHKL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 29/55 (53%)
lbx1bNP_001156784.1 Homeodomain 122..178 CDD:459649 29/55 (53%)

Return to query results.
Submit another query.