DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and gsx1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:318 Identity:93/318 - (29%)
Similarity:109/318 - (34%) Gaps:148/318 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSFLMDSLLSDRPNLSQKKEKL----------------GSPGGS------------PTAAAAV 37
            |.||||:|||:....|  :||.:.                |.|.||            |....|.
 Frog     1 MPRSFLVDSLILRETN--EKKVESSPPLFPYAVHPTHPLHGLPAGSCHSRKSGLLCVCPMCVTAS 63

  Fly    38 AAAAMLPSIPMLPYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSP 102
            ......|.||:|....|..|:.....|:         .:||:|:.....:...||          
 Frog    64 HLHPPPPGIPLLKASFSSFGTQYCPAGL---------GRQHSASTGINVSHGPAL---------- 109

  Fly   103 GSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSF- 166
                                  |:..|                             |||:|..| 
 Frog   110 ----------------------YQAAY-----------------------------PLPDPRQFH 123

  Fly   167 CTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIR 231
            |.|..:|.|                                               ...||||:|
 Frog   124 CISVDSSPS-----------------------------------------------QLSSSKRMR 141

  Fly   232 TAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSES 289
            |||||||||||||||:.|.|||||||||||..|.||||||||||||||||.||.|..|
 Frog   142 TAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 45/51 (88%)
gsx1NP_001039254.1 homeobox 137..196 50/58 (86%)
Homeobox 141..194 CDD:365835 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7109
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1341872at2759
OrthoFinder 1 1.000 - - FOG0005158
OrthoInspector 1 1.000 - - otm47600
Panther 1 1.100 - - O PTHR24339
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.140

Return to query results.
Submit another query.