DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxa6

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:299 Identity:89/299 - (29%)
Similarity:116/299 - (38%) Gaps:86/299 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PGGSPTAAAAVAAAAMLPSIP-----MLPYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAA 86
            ||..|:...:.  ...||..|     :.|:||||..|   ||..:........||.::..|...|
  Rat    11 PGSLPSGQDSF--LGQLPLYPAGYDALRPFPASYGAS---SLPDKTYTSPCFYQQSNSVLACNRA 70

  Fly    87 AAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYG 151
            :                  |...|..|.|.:..||.|      ||      .||:|..|...|:.
  Rat    71 S------------------YEYGASCFYSDKDLSGAS------PS------GNSKQRGPGDYLHF 105

  Fly   152 SPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPL-----KNHSSG 211
            ||                       ...|..:....|||....|.:....:||:     :.:|..
  Rat   106 SP-----------------------EQQYKPDSSSVQGKALHEEGTDRKYTSPVYPWMQRMNSCA 147

  Fly   212 GPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQ 276
            |.|        |....:|.|..:|..|.||||:||..|.||:|.|||||||.|.|:|:|:|||||
  Rat   148 GAV--------YGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQ 204

  Fly   277 NRRVKQKKGGSESPTFNLSTNSNGSPQASPVSPQVKVHE 315
            |||:|.||   |:...|       |.|||....:.|..|
  Rat   205 NRRMKWKK---ENKLIN-------STQASGEDSEAKAGE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 33/51 (65%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.