DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxa5a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571615.1 Gene:hoxa5a / 58055 ZFINID:ZDB-GENE-000823-9 Length:227 Species:Danio rerio


Alignment Length:221 Identity:72/221 - (32%)
Similarity:100/221 - (45%) Gaps:36/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SSPGSLYHPYAQLFASKRKSSGFSNYEGCYP---SPPL---SANPNSQQLPPIHNLYGSPVVGGL 158
            ||||       ...:|..::..:.:.....|   :.|:   ||.|:|..| |..:|..|||    
Zfish    20 SSPG-------HFLSSGERTQSYKDSPTATPVRYNQPVTASSAEPSSDHL-PCSSLANSPV---- 72

  Fly   159 PLPEPGSFCTSPSASSSASLDYTNNFDEPQGKR--FKHESSCSPNSSPLKNHSSGGPVEITPLI- 220
              .|........|.||:|. ..:.:|.....:.  .|..||......|....::...|...|.| 
Zfish    73 --SEQSHRALKISLSSTAG-SASKSFGTVLSREGVSKVSSSMEEEKPPGSGQTASQNVSEAPQIY 134

  Fly   221 -----------NDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIW 274
                       |......||.|||:|..|.||||:||..|.||:|.||||||:.|.|||:|:|||
Zfish   135 PWMRKLHISHDNLAGPEGKRPRTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIW 199

  Fly   275 FQNRRVKQKKGGSESPTFNLSTNSNG 300
            |||||:|.|| .::..:.|::...:|
Zfish   200 FQNRRMKWKK-DNKLKSMNMAAAGSG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
hoxa5aNP_571615.1 Homeobox 155..208 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.