DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxa4a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571610.1 Gene:hoxa4a / 58050 ZFINID:ZDB-GENE-000823-4 Length:245 Species:Danio rerio


Alignment Length:236 Identity:78/236 - (33%)
Similarity:105/236 - (44%) Gaps:54/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SNYEGCYPS-PPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSAS-SSASLDY----T 181
            |||  ..|| ||......:..:|...:.|..|...|.|..|..|:   |.:: ...|.||    |
Zfish    10 SNY--IEPSFPPCEEYHQNGYMPVSSDYYERPKDPGFPHHEEASY---PRSNYQEQSYDYGNVST 69

  Fly   182 NNFD--------EPQ------GKRFKHES--------SCSPNSSPLK-NHSSGGP--------VE 215
            |:.:        :||      |.|...||        .||..|..|. :..|..|        |.
Zfish    70 NDLNDFSDRHHAQPQSVSQNHGPRLTTESCVGSDGNKDCSLVSDALPGSQKSKEPVVYPWMKKVH 134

  Fly   216 ITPLINDYADS-SKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRR 279
            :..:...|:.. .||.|||:|..|.||||:||..|.||:|.||:|||:.:.|||:||||||||||
Zfish   135 VNTVTASYSGGVPKRSRTAYTRQQALELEKEFHFNRYLTRRRRVEIAHTMCLSERQVKIWFQNRR 199

  Fly   280 VKQKKGGSESPTFNLSTNSNGSPQASPVSPQVKVHELKVEA 320
            :|.||   :....|....|:.|..::        |.:|.:|
Zfish   200 MKWKK---DHKLPNTKIRSSSSAPSN--------HHVKTDA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
hoxa4aNP_571610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..99 17/67 (25%)
Antp-type hexapeptide 126..131 0/4 (0%)
Homeobox 150..203 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..245 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.