Sequence 1: | NP_996087.2 | Gene: | ind / 2768974 | FlyBaseID: | FBgn0025776 | Length: | 320 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571610.1 | Gene: | hoxa4a / 58050 | ZFINID: | ZDB-GENE-000823-4 | Length: | 245 | Species: | Danio rerio |
Alignment Length: | 236 | Identity: | 78/236 - (33%) |
---|---|---|---|
Similarity: | 105/236 - (44%) | Gaps: | 54/236 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 SNYEGCYPS-PPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSAS-SSASLDY----T 181
Fly 182 NNFD--------EPQ------GKRFKHES--------SCSPNSSPLK-NHSSGGP--------VE 215
Fly 216 ITPLINDYADS-SKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRR 279
Fly 280 VKQKKGGSESPTFNLSTNSNGSPQASPVSPQVKVHELKVEA 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ind | NP_996087.2 | Homeobox | 231..283 | CDD:278475 | 34/51 (67%) |
hoxa4a | NP_571610.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 34..99 | 17/67 (25%) | |
Antp-type hexapeptide | 126..131 | 0/4 (0%) | |||
Homeobox | 150..203 | CDD:278475 | 34/52 (65%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 205..245 | 6/33 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |