DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxa3a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571609.1 Gene:hoxa3a / 58049 ZFINID:ZDB-GENE-000823-3 Length:411 Species:Danio rerio


Alignment Length:291 Identity:89/291 - (30%)
Similarity:119/291 - (40%) Gaps:90/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ASYV-GSYLFSLGIQQQ---------QQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYH 107
            |:|. ||.::| |:..|         .|||..|..||.:.....|.:.   |.|.:|        
Zfish     4 ATYCDGSAIYS-GLPYQSANGLGYDASQQQYLQALHAESEYHRPACSL---QSPGIS-------- 56

  Fly   108 PYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSA 172
              |.|..|...|.......|. .:.....:.|.|  ||                      |:||.
Zfish    57 --AGLHTSNEMSEVCQQINGT-QATVTDTSDNKQ--PP----------------------TAPSG 94

  Fly   173 -SSSASLDYTNNFD---------EPQGKRFKH-------------ESSCSPNSSPLKNHSSGGPV 214
             ||.:||:...|.|         .|.....||             :.||    |.:...|..|..
Zfish    95 PSSPSSLNQIPNIDSAAKNPVHVSPTPSTRKHIFPWMKESRQNTKQKSC----SIISVESCAGRQ 155

  Fly   215 EITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRR 279
            :..|    .:.:|||.|||:||.||:|||:||..|.||.|.||:|:||.|.|:|:|:||||||||
Zfish   156 KSPP----GSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRR 216

  Fly   280 VKQKKG----------GSESPTFNLSTNSNG 300
            :|.||.          |::||...:|.:|.|
Zfish   217 MKYKKDQKGLGMMPSPGAQSPHSPVSLSSGG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
hoxa3aNP_571609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..126 14/70 (20%)
Antp-type hexapeptide 127..132 0/4 (0%)
Homeobox 168..220 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..250 6/25 (24%)
DUF4074 347..409 CDD:290032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.