DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxa9b

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571608.1 Gene:hoxa9b / 58048 ZFINID:ZDB-GENE-000823-2 Length:258 Species:Danio rerio


Alignment Length:268 Identity:80/268 - (29%)
Similarity:114/268 - (42%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YVGSYL-----------FSLGIQQQQQQQQ-------QQQQHAAAAAAAAAAAAALQQHPHVSSS 101
            |..|:|           ||.|...|||.::       :|:.:...|.::...|:.....|   :.
Zfish    10 YADSHLPHENDDHLAPRFSSGPVVQQQSRELTLLEYSEQEPYTFQAKSSIFGASWSPVQP---TG 71

  Fly   102 PGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIH-NLYGSPVVGGLPLPEPGS 165
            ....||||.....|...|.|.|...  :...||.|.|.:......| ::...|:||       ..
Zfish    72 ASIAYHPYIHHPCSTGDSDGASVRP--WALEPLPALPFTGLSTDTHQDIKLEPLVG-------SG 127

  Fly   166 FCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEI------------TP 218
            .||    :.:..:..|:| :..|.:|...:.:.|..|     |....|.|.            .|
Zfish   128 ECT----THTLLVAETDN-NTTQTERKVPDDAVSNGS-----HDEKIPAETKLDLDPSKCNQDNP 182

  Fly   219 LIN-DYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQ 282
            |.| .:|.|:::.|..:|..|.||||:||..|.||||.||.|:|..|.|:|:||||||||||:|.
Zfish   183 LSNWLHAKSTRKKRCPYTKHQTLELEKEFLFNMYLSRDRRYEVARLLNLTERQVKIWFQNRRMKM 247

  Fly   283 KKGGSESP 290
            ||...:.|
Zfish   248 KKCNKDRP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
hoxa9bNP_571608.1 Hox9_act 1..174 CDD:282473 40/185 (22%)
Homeobox 195..248 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5213
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.