DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxc6b

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_005172831.1 Gene:hoxc6b / 58045 ZFINID:ZDB-GENE-000822-1 Length:228 Species:Danio rerio


Alignment Length:220 Identity:72/220 - (32%)
Similarity:99/220 - (45%) Gaps:65/220 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 YPSPPLSANPNSQQ--LPPI----------------------HNLYGSP-------VVGGLPLP- 161
            :.:|.||.:.||.|  ||.:                      :.:|.:|       |:.|...| 
Zfish     5 FTNPSLSCHLNSGQEVLPSVAISSTNYDPVRHFSPYGAAVAQNRIYSNPFYSHQENVMFGSSRPY 69

  Fly   162 EPGS-----------FCTSPSASSSASLDYTNNFDEPQGKRFKHESSCS--PNSSPLKNHSSGGP 213
            :.||           .|......:..||  |.::...|||..:.:.|..  |....:.:||..| 
Zfish    70 DYGSNMFYQDKDVLPSCRQGFGQTQGSL--TQDYASDQGKTMEPKGSVQIYPWMQRMNSHSGVG- 131

  Fly   214 VEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNR 278
                     |....:|.|..::..|.||||:||.:|.||:|.|||||||.|.|||:|:|||||||
Zfish   132 ---------YGSDRRRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNR 187

  Fly   279 RVKQKKGGSESPTFNLST--NSNGS 301
            |:|.||   ||   ||::  |.|||
Zfish   188 RMKWKK---ES---NLTSILNDNGS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 33/51 (65%)
hoxc6bXP_005172831.1 Homeobox 140..192 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.