DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and meox2a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_017206696.1 Gene:meox2a / 556898 ZFINID:ZDB-GENE-080613-1 Length:302 Species:Danio rerio


Alignment Length:301 Identity:82/301 - (27%)
Similarity:114/301 - (37%) Gaps:105/301 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSDRPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPSIPMLPYP---ASYVGSYLFSLGIQQQQQQQ 72
            ||..|:||         ..||.:...|:.           ||   ....|.:...|.:.|||...
Zfish    32 LSSYPDLS---------SSSPPSTCIVSG-----------YPGEDGGLFGGHQRGLSVSQQQHHH 76

  Fly    73 QQQQQHAA--------AAAAAAAAAAALQ-----QHPHVSSS---PG--SLYHPYAQLFASKRKS 119
            .....|.|        .:::|:.:||.::     ..|...||   ||  ||              
Zfish    77 HHHHHHLAQQGGWHLPQSSSASPSAAGVRLGLGISGPDSGSSDVGPGGPSL-------------- 127

  Fly   120 SGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNF 184
                    |..:|.|.|...|.         .|.|.||    :.|....||:.:...:....::.
Zfish   128 --------CASTPSLGAGVPSG---------ASCVPGG----DFGRHTMSPAEAEKRNSKRRSDS 171

  Fly   185 DEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHN 249
            .|.|...:|.:.|..|                           ::.|||||..|:.|||.||:|:
Zfish   172 SESQDGNYKSDVSSKP---------------------------RKERTAFTKEQIRELEAEFAHH 209

  Fly   250 AYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK--KGGSE 288
            .||:||||.|||..|.|:|:|||:||||||:|.|  |||.:
Zfish   210 NYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
meox2aXP_017206696.1 COG5576 161..267 CDD:227863 43/117 (37%)
Homeobox 191..243 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.