DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and gsx2

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001017168.1 Gene:gsx2 / 549922 XenbaseID:XB-GENE-492505 Length:248 Species:Xenopus tropicalis


Alignment Length:323 Identity:99/323 - (30%)
Similarity:118/323 - (36%) Gaps:143/323 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSFLMDSLL----SDRPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPSIPMLPYPASYVGSYLF 61
            |||||.:|||:    |.||                              ||.||           
 Frog     1 MSRSFYVDSLIIKDSSSRP------------------------------IPALP----------- 24

  Fly    62 SLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYE 126
                                         .|..|.|         |.:.|.|..           
 Frog    25 -----------------------------DLSHHHH---------HHHGQDFLL----------- 40

  Fly   127 GCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSP--------SASSSASL----- 178
                       |.|...|.:.::: :||   .|..:.||||..|        |:.:|..|     
 Frog    41 -----------PISMPSPTVMSVH-APV---CPSRKSGSFCVCPICVASHLHSSRNSIPLLKGHF 90

  Fly   179 -----DYTNNFDE---PQGKRFKHESSCSPN---SSPLKNH--SSGGPVEITPLINDYADSSKRI 230
                 .|.....:   |......|...|||.   :.|.:.|  :.||..      |..|.:.||:
 Frog    91 PNGEAQYCQRVSQQPSPAMVHPAHSPVCSPTYNVTDPRRFHCMTMGGAE------NSQAQNGKRM 149

  Fly   231 RTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK--GGSESPT 291
            ||||:||||||||||||.|.|||||||||||..|.||||||||||||||||.||  .||:..|
 Frog   150 RTAFSSTQLLELEREFSSNMYLSRLRRIEIATYLSLSEKQVKIWFQNRRVKHKKENKGSQRNT 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 45/51 (88%)
gsx2NP_001017168.1 Homeobox 150..203 CDD:365835 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7109
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1341872at2759
OrthoFinder 1 1.000 - - FOG0005158
OrthoInspector 1 1.000 - - otm47600
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.