DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxb3

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001015971.1 Gene:hoxb3 / 548725 XenbaseID:XB-GENE-482576 Length:386 Species:Xenopus tropicalis


Alignment Length:248 Identity:80/248 - (32%)
Similarity:109/248 - (43%) Gaps:67/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQ---------------QLPPIHNLYGSPVV 155
            |:....||......:|...|||...|.|.|::.:::               .|....||.||   
 Frog     6 YYDNPTLFGGYPYQAGSLGYEGPQQSFPTSSHMDNEFQRSSCSLQSLGHSGPLVKAKNLNGS--- 67

  Fly   156 GGLPLPEPGSFCTSPSASSSAS--LDYTNNFDEPQGKRFKHESSCS-PNSSPLKNHSSGGPV--E 215
                       |..|:.||..|  |..|.|   |........|..| ...||.|:.:||.|.  :
 Frog    68 -----------CMRPNLSSEQSQPLSPTAN---PSSNTNSSSSQASLSKPSPAKSQASGSPASKQ 118

  Fly   216 ITPLINDY--------------------------ADSSKRIRTAFTSTQLLELEREFSHNAYLSR 254
            |.|.:.:.                          :.:|||.|||:||.||:|||:||..|.||.|
 Frog   119 IFPWMKESRQNSKQKSSPPAPAAESCGGDRSPPGSSASKRARTAYTSAQLVELEKEFHFNRYLCR 183

  Fly   255 LRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNG-SPQASP 306
            .||:|:||.|.|||:|:||||||||:|.||   :.....:|::|.| ||.::|
 Frog   184 PRRVEMANLLNLSERQIKIWFQNRRMKYKK---DQKVKGMSSSSGGASPTSTP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
hoxb3NP_001015971.1 Homeobox 160..212 CDD:306543 35/51 (69%)
DUF4074 325..384 CDD:315871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I4928
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.