DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxa7

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001102703.2 Gene:Hoxa7 / 500126 RGDID:1587253 Length:229 Species:Rattus norvegicus


Alignment Length:241 Identity:73/241 - (30%)
Similarity:109/241 - (45%) Gaps:47/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQ-------------LPPIHNLYGSPVV 155
            |.|:..| ||:  :.::|.|.::...|: ..|..||||:             :|.::|: .||:.
  Rat     3 SSYYVNA-LFS--KYTAGASLFQNAEPT-SCSFAPNSQRSGYGPGAGAFASNVPGLYNV-NSPLY 62

  Fly   156 GGLPLPEPGSFCTSPSASSSASLDYTNNF-----DEPQGKRFKHESSCSPNSSPLKNHSSGGPVE 215
            ..   |...|:.....|.:.....|..|.     |..:|       :|......:.:    ||.|
  Rat    63 QN---PFASSYGLGADAYNLPCASYDQNIPGLCSDLAKG-------ACDKADEGVLH----GPAE 113

  Fly   216 ----ITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQ 276
                |.|.:.......||.|..:|..|.||||:||..|.||:|.||||||:.|.|:|:|:|||||
  Rat   114 ASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQ 178

  Fly   277 NRRVKQK---KGGSESPTFNLSTNSNGSPQASPVSPQVKVHELKVE 319
            |||:|.|   |..|::||   :...:..|..|..:.:....|.:.|
  Rat   179 NRRMKWKKEHKDESQAPT---AVPEDAVPSVSTAADKADEEEEEEE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
Hoxa7NP_001102703.2 Homeobox 133..185 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.