DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxb4

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001094257.1 Gene:Hoxb4 / 497988 RGDID:1560113 Length:250 Species:Rattus norvegicus


Alignment Length:253 Identity:82/253 - (32%)
Similarity:101/253 - (39%) Gaps:86/253 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SPGSLYHPYAQLFASKRKSSGF--------------SNYEGCY--------PSPPLSANPNSQQL 143
            |||.    ||   ..:|:.|||              ..|..|.        |.||....|.....
  Rat    34 SPGY----YA---GGQRRESGFQPEAAFGRRAPCTVQRYAACRDPGPPPPPPPPPPPPPPGLSPR 91

  Fly   144 PPIHNLYG---------SPVVGGLPLPEPGSFCTS----PSASSSASLDYTNNFDEP---QGKRF 192
            .|:.:..|         |.||...|.|.|   |..    ||.|.||.       .||   ...|.
  Rat    92 APVQSTAGALLPEPGQRSEVVSSSPPPPP---CAQNPLHPSPSHSAC-------KEPVVYPWMRK 146

  Fly   193 KHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRR 257
            .|.|:.:|      |::.|.|              ||.|||:|..|:||||:||.:|.||:|.||
  Rat   147 VHVSTVNP------NYAGGEP--------------KRSRTAYTRQQVLELEKEFHYNRYLTRRRR 191

  Fly   258 IEIANRLRLSEKQVKIWFQNRRVKQKK-----------GGSESPTFNLSTNSNGSPQA 304
            :|||:.|.|||:|:||||||||:|.||           ||:...........||.|.|
  Rat   192 VEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGTAGAAGGPPGRPNGGPPA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
Hoxb4NP_001094257.1 Homeobox 164..218 CDD:395001 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.