DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxb5

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001178854.1 Gene:Hoxb5 / 497987 RGDID:1562292 Length:269 Species:Rattus norvegicus


Alignment Length:306 Identity:90/306 - (29%)
Similarity:125/306 - (40%) Gaps:82/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SFLMDSLLSDRPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPSIPMLPYPASYVGSYLFSL-GIQQ 67
            |:.::|.....|| ....:.|....||..:.:....|||            :.|||.::. |:..
  Rat     3 SYFVNSFSGRYPN-GPDYQLLNYGSGSSLSGSYRDPAAM------------HTGSYGYNYNGMDL 54

  Fly    68 QQQQQQQQQQHAAAAAAAAAAAAALQQHPHV--SSSPGSLYHPYAQLFASKRKSSGFSNYEGCYP 130
            ...:......|..|...::.|..|..|.|..  ::|..||..|     .|...::|.|:  |..|
  Rat    55 SVNRSSASSSHFGAVGESSRAFPASAQEPRFRQATSSCSLSSP-----ESLPCTNGDSH--GAKP 112

  Fly   131 SPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSAS---LDYTNNFDEPQGKRF 192
            |   :::|:.|..|                           |||||:   :|..:...||     
  Rat   113 S---ASSPSDQATP---------------------------ASSSANFTEIDEASASSEP----- 142

  Fly   193 KHESSCSPNSSPLKNH--------SSGGPVEITPLINDY-----------ADSSKRIRTAFTSTQ 238
              |.:.|..|||....        |:..|...||.|..:           ....||.|||:|..|
  Rat   143 --EEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQ 205

  Fly   239 LLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK 284
            .||||:||..|.||:|.||||||:.|.|||:|:||||||||:|.||
  Rat   206 TLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxb5NP_001178854.1 PRK07003 <67..>171 CDD:235906 33/147 (22%)
Homeobox 198..251 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.