DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and gsx1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001012251.1 Gene:gsx1 / 449875 ZFINID:ZDB-GENE-041008-135 Length:243 Species:Danio rerio


Alignment Length:340 Identity:108/340 - (31%)
Similarity:130/340 - (38%) Gaps:142/340 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSFLMDSLLSDRPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPSIPMLPYPASYVGSYLFSLGI 65
            |.||||:|||:     |.:..||  ....||               |:.||              
Zfish     1 MPRSFLVDSLI-----LRENSEK--GTENSP---------------PLFPY-------------- 29

  Fly    66 QQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCY- 129
                                    |....||..|.|.||.:...|.|.              |: 
Zfish    30 ------------------------AVHPSHPLHSLSAGSCHSRKAGLL--------------CFC 56

  Fly   130 ---------PSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSP-----SASSSASLD- 179
                     ||||        .||.|...:  |..|       ..:|.|.     |.||..:|: 
Zfish    57 PLCVTSQLHPSPP--------ALPLIKASF--PAFG-------TQYCHSALSRQHSTSSGVNLNS 104

  Fly   180 ----YTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLL 240
                |...:..|..::| |..|...:||.|:                   ||||:||||||||||
Zfish   105 GSGLYQAAYPVPDPRQF-HCISIENSSSQLQ-------------------SSKRMRTAFTSTQLL 149

  Fly   241 ELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK----GGSESPTFNLSTNSN-G 300
            ||||||:.|.|||||||||||..|.||||||||||||||||.||    |...:...|...:|: .
Zfish   150 ELEREFTSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSGSHRTGAHNCKCSSSLS 214

  Fly   301 SPQAS------PVSP 309
            |.:.|      |:||
Zfish   215 SARCSEEEDDLPMSP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 45/51 (88%)
gsx1NP_001012251.1 Homeobox 140..192 CDD:278475 45/51 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7117
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1341872at2759
OrthoFinder 1 1.000 - - FOG0005158
OrthoInspector 1 1.000 - - otm26469
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24339
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
88.540

Return to query results.
Submit another query.