DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxc8a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001005771.1 Gene:hoxc8a / 449648 ZFINID:ZDB-GENE-990415-114 Length:250 Species:Danio rerio


Alignment Length:246 Identity:74/246 - (30%)
Similarity:97/246 - (39%) Gaps:79/246 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHP--HVS----------SSPG 103
            :|.|...|:....|             |.|||...        |||  ||.          |:||
Zfish    28 FPQSVARSHTLVYG-------------HGAAAPGF--------QHPSHHVQDFFHHGTTGISNPG 71

  Fly   104 SLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCT 168
            ...:|.|  .|....::.|..|| ..|..|               |||:        .:..:...
Zfish    72 YQQNPCA--LACHGDATKFYGYE-ALPRQP---------------LYGT--------QQEATLAQ 110

  Fly   169 SPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTA 233
            .|...||.|    .|..|.||       ..|.||||..         :.|.:..:|...:..|..
Zfish   111 YPDCKSSNS----TNPGEGQG-------HLSQNSSPSL---------MFPWMRPHAPGRRNGRQT 155

  Fly   234 FTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK 284
            ::..|.||||:||..|.||:|.||||:::.|.|:|:||||||||||:|.||
Zfish   156 YSRYQTLELEKEFLFNPYLTRKRRIEVSHALSLTERQVKIWFQNRRMKWKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 30/51 (59%)
hoxc8aNP_001005771.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..152 15/59 (25%)
Antp-type hexapeptide. /evidence=ECO:0000255 138..143 1/4 (25%)
Homeobox 153..205 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..250 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.