DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and MEOX2

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_005915.2 Gene:MEOX2 / 4223 HGNCID:7014 Length:304 Species:Homo sapiens


Alignment Length:275 Identity:82/275 - (29%)
Similarity:118/275 - (42%) Gaps:89/275 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QHAAAAAAAAAAAAALQQHPHVSSSPG----SLYHPYAQLFASKRKS--SGFSNYEGCYPS---- 131
            :|.......:..|.|...||...||..    |.:..|.:|..|....  :|:.|.||.:.|    
Human     2 EHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHR 66

  Fly   132 ----------------------------PPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGS--- 165
                                        |.:|:.|::.:    |:|...|..|| | ||.||   
Human    67 GHHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAAR----HSLCLQPDSGG-P-PELGSSPP 125

  Fly   166 -FCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNS------SPLK-NHSSGGPVEITPLIND 222
             .|::.|:..|::         |.|      ::|:|..      ||.: ...|||..:     :|
Human   126 VLCSNSSSLGSST---------PTG------AACAPGDYGRQALSPAEAEKRSGGKRK-----SD 170

  Fly   223 YADSS------------KRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWF 275
            .:||.            ::.|||||..|:.|||.||:|:.||:||||.|||..|.|:|:|||:||
Human   171 SSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWF 235

  Fly   276 QNRRVKQK--KGGSE 288
            ||||:|.|  |||.:
Human   236 QNRRMKWKRVKGGQQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
MEOX2NP_005915.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..192 28/154 (18%)
COG5576 160..284 CDD:227863 44/96 (46%)
Homeobox 191..243 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.