DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and MEOX1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:274 Identity:88/274 - (32%)
Similarity:118/274 - (43%) Gaps:73/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 AAAAAAAALQ---------QHPHVSSSPGS-LYHPYAQLFASKRKSSGFSNYEGCYP---SPPLS 135
            ||::...:||         ::||...:..| |.|.....|:..:|....:.....||   :..|:
Human     4 AASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLA 68

  Fly   136 ANPNS---------QQLP----------PIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASL--- 178
            |.|:|         :|.|          |:.:....|..|    |..||   ....:||..|   
Human    69 ATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSG----PAGGS---KEMGTSSLGLVDT 126

  Fly   179 ------DY-----TNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRT 232
                  ||     |.|..|.:..|.:.|||        .|..:.|..|       .:..:::.||
Human   127 TGGPGDDYGVLGSTANETEKKSSRRRKESS--------DNQENRGKPE-------GSSKARKERT 176

  Fly   233 AFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK--KGGSE-SPTFNL 294
            |||..||.|||.||:|:.||:||||.|||..|.|||:|||:||||||:|.|  |||.. ||  |.
Human   177 AFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISP--NG 239

  Fly   295 STNSNGSPQASPVS 308
            ....:|...|||.|
Human   240 QDPEDGDSTASPSS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 36/51 (71%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 24/113 (21%)
Homeobox 175..227 CDD:306543 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.