DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Antp

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:320 Identity:98/320 - (30%)
Similarity:126/320 - (39%) Gaps:91/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PASYVGSYL------FSLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQQH-PHVSSSPGSLYHPY 109
            |:|.||..:      ..||:.|||||||||.........|..|...|||. |.|:.   .:.||.
  Fly    89 PSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQ---QVTHPQ 150

  Fly   110 AQ-----LFASKRKSSGFSNYEGCYP---SPPL-----SANPNSQQLPPIHNLYGSPVVGGLPLP 161
            .|     ::||.:..:..... |..|   ||||     ..:.|:|...|.|  .|.|        
  Fly   151 QQQQQPVVYASCKLQAAVGGL-GMVPEGGSPPLVDQMSGHHMNAQMTLPHH--MGHP-------- 204

  Fly   162 EPGSFCTSPSASSSASLDYT------------NNFD---------------EPQGKRFK------ 193
                         .|.|.||            |:.:               .|||...:      
  Fly   205 -------------QAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQ 256

  Fly   194 ----HESSCSPNSSPLKNHSSGGPVEITPLINDY---ADSSKRIRTAFTSTQLLELEREFSHNAY 251
                |....:|.|....:.|||.|..:.|.:...   ....||.|..:|..|.||||:||..|.|
  Fly   257 MHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRY 321

  Fly   252 LSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSESPT-FNLSTNSNGSPQASPVSPQ 310
            |:|.||||||:.|.|:|:|:||||||||:|.||   |:.| ....:...|.....|.|||
  Fly   322 LTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK---ENKTKGEPGSGGEGDEITPPNSPQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 32/168 (19%)
Homeobox 301..354 CDD:395001 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.