DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and ftz

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:311 Identity:93/311 - (29%)
Similarity:132/311 - (42%) Gaps:78/311 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AAAAVAAAAMLPSI--PMLPYPA---SYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAAL 92
            ||:.:||....||.  .:|..|.   .|...|.::       ..:|.::..|.:....|:.|.:.
  Fly    95 AASIIAAVEERPSTLRALLTNPVKKLKYTPDYFYT-------TVEQVKKAPAVSTKVTASPAPSY 152

  Fly    93 QQH----PHVSSSPG----SLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNL 149
            .|.    |..|:|..    .:|.|.:|  ..|.|:..|:       :|| ...|.|  |||:..:
  Fly   153 DQEYVTVPTPSASEDVDYLDVYSPQSQ--TQKLKNGDFA-------TPP-PTTPTS--LPPLEGI 205

  Fly   150 YGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPV 214
            ...|              .||...||:::          .:...|....:||.:...|.|.   :
  Fly   206 STPP--------------QSPGEKSSSAV----------SQEINHRIVTAPNGAGDFNWSH---I 243

  Fly   215 EITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRR 279
            |.| |.:|..| |||.|..:|..|.||||:||..|.|::|.|||:|||.|.|||:|:||||||||
  Fly   244 EET-LASDCKD-SKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRR 306

  Fly   280 VKQKK-----------GGSES----PTFNLSTNSNGSPQASPVSPQVKVHE 315
            :|.||           |...:    |....||.:.|:|.. || |....|:
  Fly   307 MKSKKDRTLDSSPEHCGAGYTAMLPPLEATSTATTGAPSV-PV-PMYHHHQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 43/199 (22%)
Homeobox 257..310 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439779
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.