DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and mnx2a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001009886.2 Gene:mnx2a / 406205 ZFINID:ZDB-GENE-040415-1 Length:309 Species:Danio rerio


Alignment Length:293 Identity:82/293 - (27%)
Similarity:112/293 - (38%) Gaps:99/293 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRSFLMDSLLSDRPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPSIPMLPYPASYVGSYLFSLGIQ 66
            |::|.:|:|||:.   ||:..:..|||                               |.|.|:.
Zfish     4 SKNFRIDALLSES---SQQIVRGDSPG-------------------------------LCSEGVD 34

  Fly    67 QQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPG--SLYHPYAQLFASKRKSSGFSNYEGCY 129
            ....::.:.           :...|.|....|...||  ::.||     .....|.|  :..|.|
Zfish    35 VDMCKRTEN-----------SLPRAFQLQTGVIPKPGMLNISHP-----GLTSLSQG--SMPGMY 81

  Fly   130 PSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKH 194
            |||..|......|.|                    ||..|             .|.:|.....| 
Zfish    82 PSPMYSITALGAQHP--------------------SFAYS-------------GFTQPYPDHLK- 112

  Fly   195 ESSCSPNSSPLKNHSSGGPVEITPLINDYADS--------SKRIRTAFTSTQLLELEREFSHNAY 251
             ::....|.||::....|  .|.|.:.||:.:        .:|.||||||.||||||.:|..|.|
Zfish   113 -AAAMAGSLPLEHWLRAG--LIMPRLADYSGAPQSGLIGKCRRPRTAFTSQQLLELENQFKLNKY 174

  Fly   252 LSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK 284
            |||.:|.|:|..|.|:|.||||||||||:|.|:
Zfish   175 LSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
mnx2aNP_001009886.2 Homeobox 153..206 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.