DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Meox1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:296 Identity:83/296 - (28%)
Similarity:107/296 - (36%) Gaps:111/296 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AAAAMLPSIPMLPYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSP 102
            ::|:.||..|  |.|.|:                 .|:....|.||....:.:.|...||  |.|
  Rat    30 SSASGLPHYP--PTPFSF-----------------HQKSDFPATAAYPDFSTSCLAATPH--SLP 73

  Fly   103 GSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPE----- 162
                          |....|:.....:|           |.|..|          .|:.|     
  Rat    74 --------------RAERIFNEQHPAFP-----------QTPDWH----------FPISEAGQRL 103

  Fly   163 ---PGSFCTSPSASSSASLDYTNNF-------------DEPQGKRFKHESSCSPNSSPLKNHSSG 211
               |........|.|...:|.|...             .|.:..|.|.|.|.:|       .:.|
  Rat   104 NLGPAGSAREMGAGSPGLVDGTGGLGEDCMVLGTIAHETEKKLSRRKKERSDNP-------ENGG 161

  Fly   212 GPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQ 276
            |..|       .:..:::.|||||..||.|||.||:|:.||:||||.|||..|.|||:|||:|||
  Rat   162 GKPE-------GSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQ 219

  Fly   277 NRRVKQK--KGGSESPTFNLSTNSNGSPQASPVSPQ 310
            |||:|.|  |||                  .|||||
  Rat   220 NRRMKWKRVKGG------------------QPVSPQ 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 36/51 (71%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 54/131 (41%)
Homeobox 174..227 CDD:395001 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.