DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and pnx

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_840087.1 Gene:pnx / 352939 ZFINID:ZDB-GENE-030328-42 Length:182 Species:Danio rerio


Alignment Length:136 Identity:54/136 - (39%)
Similarity:66/136 - (48%) Gaps:29/136 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 DYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELE 243
            :.:||.:.|     |..|.....|:|...::|...|:           |||||||||..||..||
Zfish    35 EISNNRESP-----KTTSPTQEPSAPNIANASAAKVK-----------SKRIRTAFTLDQLRILE 83

  Fly   244 REFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK-----GGSESPTFNLSTNSNGSPQ 303
            |.|..:.|||...|..||:.|.|||.||||||||||.|.||     ||.|        .|:.:|.
Zfish    84 RSFQSSHYLSVFERHCIASALGLSETQVKIWFQNRRTKWKKELDGHGGEE--------QSHCAPT 140

  Fly   304 ASPVSP 309
            |...:|
Zfish   141 ALTQNP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
pnxNP_840087.1 Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 8/32 (25%)
Homeobox 71..123 CDD:278475 32/51 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.