DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HOXD4

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:220 Identity:73/220 - (33%)
Similarity:95/220 - (43%) Gaps:53/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GCYPSPPLSANPNSQQLP------PIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFD 185
            |.||.|.....|.....|      |.......|...|.....||..|.:|.|...|.|.....:.
Human    50 GLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYS 114

  Fly   186 E------PQGKRFK------------HESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRT 232
            :      |.|...|            |.:|.:|      |::.|.|              ||.||
Human   115 QSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNP------NYTGGEP--------------KRSRT 159

  Fly   233 AFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK--------KGGSES 289
            |:|..|:||||:||..|.||:|.||||||:.|.|||:|:||||||||:|.|        ||.|.|
Human   160 AYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSS 224

  Fly   290 PTFNLSTNSNGSPQASPVSPQVKVH 314
            .:.:.|.:|:.:| :..:.|..|.|
Human   225 SSSSSSCSSSVAP-SQHLQPMAKDH 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 18/76 (24%)
Antp-type hexapeptide 133..138 0/4 (0%)
Homeobox 157..210 CDD:306543 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.