DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HOXD3

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_008829.3 Gene:HOXD3 / 3232 HGNCID:5137 Length:432 Species:Homo sapiens


Alignment Length:277 Identity:89/277 - (32%)
Similarity:123/277 - (44%) Gaps:64/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SIPMLPYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSS-PGSLYHP 108
            |.|..|||.....|.|               ......:|.:..::|.|:...|..:. .||...|
Human    44 STPHQPYPPPAAASSL---------------DTDYPGSACSIQSSAPLRAPAHKGAELNGSCMRP 93

  Fly   109 YAQLFASKRKSSGFS-----NYEGCYPSPPLSANPNSQQLPPIHNLYGSPV--VGGLPLPEPGSF 166
            ..   .:.:...|.|     |.|...|.||    |....|||     .||.  .||:|..:|.. 
Human    94 GT---GNSQGGGGGSQPPGLNSEQQPPQPP----PPPPTLPP-----SSPTNPGGGVPAKKPKG- 145

  Fly   167 CTSPSASSSASLDYTNNFD--EPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKR 229
              .|:||||::......|.  :...:..|.::||:......::.|..||            :|||
Human   146 --GPNASSSSATISKQIFPWMKESRQNSKQKNSCATAGESCEDKSPPGP------------ASKR 196

  Fly   230 IRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK-----KGGSES 289
            :|||:||.||:|||:||..|.||.|.||:|:||.|.|:|:|:||||||||:|.|     ||...|
Human   197 VRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGILHS 261

  Fly   290 PTFNLSTNSNGSPQASP 306
            |       ::.||:.||
Human   262 P-------ASQSPERSP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
HOXD3NP_008829.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..62 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..197 37/155 (24%)
Antp-type hexapeptide 160..165 1/4 (25%)
Homeobox 198..250 CDD:306543 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..280 8/26 (31%)
DUF4074 369..430 CDD:315871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.