DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HOXD1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:332 Identity:98/332 - (29%)
Similarity:133/332 - (40%) Gaps:99/332 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPS------IPMLPYPASYVGSYLFSLGIQQQQQQQ 72
            ||...|....||:..|:..:...:|||...||      .|.:|.||:              .|..
Human    33 RPVALQPAFPLGNGDGAFVSCLPLAAARPSPSPPAAPARPSVPPPAA--------------PQYA 83

  Fly    73 QQQQQHAAAAAAAAAAAAALQQHPHVSSSP---------------GSLYHPYAQLFASKRKSSGF 122
            |...:.|....||.||||....:..:.|.|               ||..|     :|:....||.
Human    84 QCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVH-----YATSAVFSGG 143

  Fly   123 SNY-------------EGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASS 174
            .::             .|.:|: .|.|:.:           |.|.......|.||::..|.|.:|
Human   144 GSFLLSGQVDYAAFGEPGPFPA-CLKASAD-----------GHPGAFQTASPAPGTYPKSVSPAS 196

  Fly   175 SASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDY--ADSSKRIRTAFTST 237
            .....: :.|:..:.||               |.|..|.      :.:|  |..|..|||.|::.
Human   197 GLPAAF-STFEWMKVKR---------------NASKKGK------LAEYGAASPSSAIRTNFSTK 239

  Fly   238 QLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNGSP 302
            ||.|||:||..|.||:|.|||||||.|.|::.||||||||||:||||...|.   .|:|      
Human   240 QLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREG---LLAT------ 295

  Fly   303 QASPVSP 309
             |.||:|
Human   296 -AIPVAP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.