DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HOXC8

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_073149.1 Gene:HOXC8 / 3224 HGNCID:5129 Length:242 Species:Homo sapiens


Alignment Length:239 Identity:70/239 - (29%)
Similarity:100/239 - (41%) Gaps:59/239 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYHPYAQLFASK 116
            ||.|...:..|:|           :.||.......:|..    ..|.|......:|         
Human    21 PAYYDCRFPQSVG-----------RSHALVYGPGGSAPG----FQHASHHVQDFFH--------- 61

  Fly   117 RKSSGFSNYEGCYPSP-PLSANPNSQ-----QLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSS 175
            ..:||.|| .|...:| .||.:.::.     :..|..:|||:        .:..|....|...||
Human    62 HGTSGISN-SGYQQNPCSLSCHGDASKFYGYEALPRQSLYGA--------QQEASVVQYPDCKSS 117

  Fly   176 ASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLL 240
            |:    .|..|.||       ..:.||||..         :.|.:..:|...:..|..::..|.|
Human   118 AN----TNSSEGQG-------HLNQNSSPSL---------MFPWMRPHAPGRRSGRQTYSRYQTL 162

  Fly   241 ELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK 284
            |||:||..|.||:|.||||:::.|.|:|:||||||||||:|.||
Human   163 ELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 30/51 (59%)
HOXC8NP_073149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 13/59 (22%)
Antp-type hexapeptide 138..143 1/4 (25%)
Homeobox 153..205 CDD:306543 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.