DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HOXB5

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens


Alignment Length:216 Identity:77/216 - (35%)
Similarity:101/216 - (46%) Gaps:41/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GSLYHPYAQLFASKRKSSGFSNYEG-------CYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPL 160
            ||..:.|..:..|..:||..|::.|       .:|:|  :..|..:|.....:| .||  ..||.
Human    43 GSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPAP--AQEPRFRQAASSCSL-SSP--ESLPC 102

  Fly   161 PEPGSFCTSPSASS--------SASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNH--------S 209
            ....|....|||||        |:|.::| ..||..... :.|.:.|..|||....        |
Human   103 TNGDSHGAKPSASSPSDQATSASSSANFT-EIDEASASS-EPEEAASQLSSPSLARAQPEPMATS 165

  Fly   210 SGGPVEITPLINDY-----------ADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANR 263
            :..|...||.|..:           ....||.|||:|..|.||||:||..|.||:|.||||||:.
Human   166 TAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 230

  Fly   264 LRLSEKQVKIWFQNRRVKQKK 284
            |.|||:|:||||||||:|.||
Human   231 LCLSERQIKIWFQNRRMKWKK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 28/110 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 27/102 (26%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeobox 198..251 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.