DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HOXB4

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_076920.1 Gene:HOXB4 / 3214 HGNCID:5115 Length:251 Species:Homo sapiens


Alignment Length:250 Identity:83/250 - (33%)
Similarity:105/250 - (42%) Gaps:79/250 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SPGSLYHPYAQLFASKRKSS-----GFSNYEGCY---------PSPPLSANPNSQQLPP--IHNL 149
            |||  |:...|    :|:||     ||.....|.         |.||....|.....||  :...
Human    34 SPG--YYAGGQ----RRESSFQPEAGFGRRAACTVQRYAACRDPGPPPPPPPPPPPPPPPGLSPR 92

  Fly   150 YGSPVVGGLPLPEPGSFCTS----------------PSASSSASLDYTNNFDEP---QGKRFKHE 195
            ..:|...|..|||||..|.:                ||.|.||.       .||   ...|..|.
Human    93 APAPPPAGALLPEPGQRCEAVSSSPPPPPCAQNPLHPSPSHSAC-------KEPVVYPWMRKVHV 150

  Fly   196 SSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEI 260
            |:.:|      |::.|.|              ||.|||:|..|:||||:||.:|.||:|.||:||
Human   151 STVNP------NYAGGEP--------------KRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEI 195

  Fly   261 ANRLRLSEKQVKIWFQNRRVKQKK-----------GGSESPTFNLSTNSNGSPQA 304
            |:.|.|||:|:||||||||:|.||           ||:...........||.|:|
Human   196 AHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSAGGPPGRPNGGPRA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
HOXB4NP_076920.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134 28/105 (27%)
Antp-type hexapeptide 141..146 0/4 (0%)
Homeobox 165..218 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..251 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.