DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HOXB2

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_002136.1 Gene:HOXB2 / 3212 HGNCID:5113 Length:356 Species:Homo sapiens


Alignment Length:229 Identity:70/229 - (30%)
Similarity:89/229 - (38%) Gaps:76/229 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 QQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGG 157
            |..|.:.....:|..|.:|    ||...|     ...|.||          ||       |:...
Human    51 QTFPSLQPGASTLQRPRSQ----KRAEDG-----PALPPPP----------PP-------PLPAA 89

  Fly   158 LPLPE------------PGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSS 210
            .|.||            |....||||.::||                      .|.|      ..
Human    90 PPAPEFPWMKEKKSAKKPSQSATSPSPAASA----------------------VPAS------GV 126

  Fly   211 GGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWF 275
            |.|.:...|.......::|:|||:|:|||||||:||..|.||.|.||:|||..|.|:|:|||:||
Human   127 GSPADGLGLPEAGGGGARRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWF 191

  Fly   276 QNRRVKQKKGGSESPTFNLSTNSNGSPQASPVSP 309
            ||||:|.|:          .|.....|...|..|
Human   192 QNRRMKHKR----------QTQHREPPDGEPACP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
HOXB2NP_002136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..142 29/144 (20%)
Antp-type hexapeptide 94..99 1/4 (25%)
Homeobox 147..199 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..240 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.