DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and HOXA4

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens


Alignment Length:327 Identity:94/327 - (28%)
Similarity:130/327 - (39%) Gaps:90/327 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GSPGGSPTAAAAVAAAAMLPSIPMLPYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAA 89
            |.|||.             |.....|.|.:            |....||.|..||.......|:.
Human    34 GGPGGG-------------PGYQQPPAPPT------------QHLPLQQPQLPHAGGGREPTASY 73

  Fly    90 AALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNY---EGCYPS-PPLSANPNSQQLPPIHNLY 150
            .|    |..:..|.   :|.|.|:.:...:.....|   .|..|. ||....|.:|...|.|.|:
Human    74 YA----PRTAREPA---YPAAALYPAHGAADTAYPYGYRGGASPGRPPQPEQPPAQAKGPAHGLH 131

  Fly   151 GSPVV-GGLPLP-EPGSF-------CTS-------PSASSSASLDYTNNFDEPQGKRFK------ 193
            .|.|: ..||.| :|.:.       |.:       |:..|:.:.........|.|.:.|      
Human   132 ASHVLQPQLPPPLQPRAVPPAAPRRCEAAPATPGVPAGGSAPACPLLLADKSPLGLKGKEPVVYP 196

  Fly   194 -----HESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLS 253
                 |.|:.:|      :::.|.|              ||.|||:|..|:||||:||..|.||:
Human   197 WMKKIHVSAVNP------SYNGGEP--------------KRSRTAYTRQQVLELEKEFHFNRYLT 241

  Fly   254 RLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNGSPQASP------VSPQVK 312
            |.||||||:.|.|||:||||||||||:|.|| ..:.|...:.::::.|..|.|      .||.:.
Human   242 RRRRIEIAHTLCLSERQVKIWFQNRRMKWKK-DHKLPNTKMRSSNSASASAGPPGKAQTQSPHLH 305

  Fly   313 VH 314
            .|
Human   306 PH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 36/51 (71%)
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77 15/71 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168 17/66 (26%)
Antp-type hexapeptide 194..199 0/4 (0%)
Homeobox 218..271 CDD:278475 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.