DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and TLX2

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_057254.1 Gene:TLX2 / 3196 HGNCID:5057 Length:284 Species:Homo sapiens


Alignment Length:186 Identity:56/186 - (30%)
Similarity:81/186 - (43%) Gaps:34/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SSGFSNYEGCYPSPPLSANPNSQ--------QLPPIHNLYGSPVVGGLP-LPEPGSFCTSPSASS 174
            |.|:....|..|:..|:..|.|.        ::|....|...|..||.| :|.|...   ..|..
Human    51 SGGYHGASGYGPAGSLAPLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGL---GGAGG 112

  Fly   175 SASLDYTNNFDEP---QGKRFKHE---SSCSPNSSPLK-NHSSGGPVEITPLINDYADSSKRIRT 232
            .|.|.:      |   .|:||..:   ::.||.|...: .|         |..|......|:.||
Human   113 LAGLTF------PWMDSGRRFAKDRLTAALSPFSGTRRIGH---------PYQNRTPPKRKKPRT 162

  Fly   233 AFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSE 288
            :|:.:|:|||||.|....||:...|..:|..||:::.|||.||||||.|.::..:|
Human   163 SFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 27/55 (49%)
TLX2NP_057254.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..106 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..166 8/35 (23%)
Homeodomain 158..214 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.