DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and MNX1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_005506.3 Gene:MNX1 / 3110 HGNCID:4979 Length:401 Species:Homo sapiens


Alignment Length:379 Identity:105/379 - (27%)
Similarity:139/379 - (36%) Gaps:144/379 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRSFLMDSLLSDRP---------------NLSQKKEKLGSPGG-----------------SPTAA 34
            |::|.:|:||:..|               :|:......|..||                 .|.||
Human     4 SKNFRIDALLAVDPPRAASAQSAPLALVTSLAAAASGTGGGGGGGGASGGTSGSCSPASSEPPAA 68

  Fly    35 AAVAAAAMLPSIP--------MLPYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAA 91
            .|....|..||.|        :||.| .::|:.....|...............||||||||||||
Human    69 PADRLRAESPSPPRLLAAHCALLPKP-GFLGAGGGGGGTGGGHGGPHHHAHPGAAAAAAAAAAAA 132

  Fly    92 LQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQ----LPPIHNLYGS 152
                     :.|.|                           .|..:|...|    ||....|||.
Human   133 ---------AAGGL---------------------------ALGLHPGGAQGGAGLPAQAALYGH 161

  Fly   153 PVVGGLPLPEPGSFCTSPSASSSA----SLDYTNNFDEPQGKRFKHESSCSPNSSPLK------- 206
            ||.|         :..:.:|::.|    :|.|  ::.:.||....|.      :.|:|       
Human   162 PVYG---------YSAAAAAAALAGQHPALSY--SYPQVQGAHPAHP------ADPIKLGAGTFQ 209

  Fly   207 -----NHSSGGPV-EITPLINDYADSS-----KRIRTAFTSTQLLELEREFSHNAYLSRLRRIEI 260
                 ..|:.|.: ...|..|..|.|:     :|.||||||.||||||.:|..|.||||.:|.|:
Human   210 LDQWLRASTAGMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEV 274

  Fly   261 ANRLRLSEKQVKIWFQNRRVKQK------------------------KGGSESP 290
            |..|.|:|.||||||||||:|.|                        |||:|.|
Human   275 ATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
MNX1NP_005506.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..78 8/40 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..120 1/18 (6%)
Homeobox 244..297 CDD:278475 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..401 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.