DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxb1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_220896.4 Gene:Hoxb1 / 303491 RGDID:1310298 Length:297 Species:Rattus norvegicus


Alignment Length:308 Identity:97/308 - (31%)
Similarity:130/308 - (42%) Gaps:62/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PTAAAAVAAAAMLPSIPMLPYPA--SYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQ 93
            |:|.:|..      |.|....||  ||.|...:..|:.....||.              :...:|
  Rat    19 PSAYSAPT------SFPPSSAPAVDSYAGESRYGGGLPSSALQQN--------------SGYPVQ 63

  Fly    94 QHPH---VS--SSPGSLYHPYA---QLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLY 150
            |.|.   ||  ||..|.|.|.|   ....|:..|.|.|..:|.|..|    :....||..:.:.|
  Rat    64 QPPSSLGVSFPSSAPSGYAPAACNPSYGPSQYYSMGQSEGDGGYFHP----SSYGAQLGGLPDSY 124

  Fly   151 GSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHS------ 209
            |:..||..|.|.|     .|...:..:.::.:.:|.....:   |||||...|.|...:      
  Rat   125 GAGGVGSGPYPPP-----QPPYGTEQTSNFASAYDLLSEDK---ESSCSSEPSSLTARTFDWMKV 181

  Fly   210 SGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIW 274
            ...|.:...:......:...:||.||:.||.|||:||..|.||||.||:|||..|.|:|.|||||
  Rat   182 KRNPPKTAKVSELGLGTPGGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIW 246

  Fly   275 FQNRRVKQKK----GG----------SESPTFNLSTNSNGSPQASPVS 308
            |||||:||||    ||          .|:.......::..||:|||.|
  Rat   247 FQNRRMKQKKREREGGRVPAGPPGCPKEAAGEASDQSACTSPEASPSS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxb1XP_220896.4 Homeobox 203..255 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.